
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nicotiana tabacum (Common tobacco)
Uniprot NO.:P49729
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SSNSVSPAHDMGLVPDLPPTVAAIKNPTSKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLMRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTED DISLANSVDLGSLRDPQQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPYNLEVPTYSFLEENKLLIG
Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske-1, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5-1 Rieske iron-sulfur protein 1 Short name= RISP1 Ubiquinol-cytochrome c reductase iron-sulfur s
Gene Names:
Expression Region:47-258
Sequence Info:full length protein
You may also like
-
Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-2, mitochondrial
- Regular price
- €1.096,95 EUR
- Sale price
- €1.096,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-3, mitochondrial
- Regular price
- €1.096,95 EUR
- Sale price
- €1.096,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial
- Regular price
- €1.096,95 EUR
- Sale price
- €1.096,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-5, mitochondrial
- Regular price
- €1.096,95 EUR
- Sale price
- €1.096,95 EUR
- Regular price
-
- Unit price
- per
Sold out