Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 16, chloroplastic(CAB16)

Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 16, chloroplastic(CAB16)

SKU:CSB-CF338843NHE

Regular price €1.521,95 EUR
Regular price Sale price €1.521,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nicotiana tabacum (Common tobacco)

Uniprot NO.:P27492

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 16, chloroplastic Alternative name(s): LHCII type I CAB-16 Short name= LHCP

Gene Names:Name:CAB16

Expression Region:35-266

Sequence Info:full length protein

View full details