Gene Bio Systems
Recombinant Nicotiana sylvestris ATP synthase subunit c, chloroplastic(atpH)
Recombinant Nicotiana sylvestris ATP synthase subunit c, chloroplastic(atpH)
SKU:CSB-CF660326NHD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Uniprot NO.:Q3C1H2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV
Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpH
Expression Region:1-81
Sequence Info:full length protein
