
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:Q7S0A1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPSLLVVIFVIELFVQLVNTIGAATINNLLWRIALSLPLPLSAQFAAQRKKQKEYLAIRR ELNATSSQDEFAKWARLRRQHDKLLEDLEKRKKELDAAKTKFDRTLTTVRVVATRGLQWF LPFWYSREPMFWLPYGWFPYYVEWFASFPRAPLGSVSIVVWQWACTGVIKLVIETVMAVV GLIVAARQKQQEKQKAKQAVPAAGGGDSKAEEAK
Protein Names:Recommended name: Protein get-1 Alternative name(s): Guided entry of tail-anchored proteins 1
Gene Names:Name:get-1 ORF Names:NCU10034
Expression Region:1-214
Sequence Info:full length protein
You may also like
-
Recombinant Neurospora crassa Protein sym-1(sym-1)
- Regular price
- €1.065,95 EUR
- Sale price
- €1.065,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa Probable cytochrome b5(B23L21.190, NCU03910)
- Regular price
- €1.040,95 EUR
- Sale price
- €1.040,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa Peptidyl-prolyl cis-trans isomerase B(cpr-2)
- Regular price
- €1.128,95 EUR
- Sale price
- €1.128,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa Protein yop-1(yop-1)
- Regular price
- €1.061,95 EUR
- Sale price
- €1.061,95 EUR
- Regular price
-
- Unit price
- per
Sold out