
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:Q12635
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIQVAKIIGTGLATTGLIGAGIGIGVVFGSLIIGVSRNPSLKSQLFAYAILGFAFSEATG LFALMMAFLLLYVA
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:atp-9 ORF Names:NCU16027
Expression Region:1-74
Sequence Info:full length protein
You may also like
-
Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(oli)
- Regular price
- €1.221,95 EUR
- Sale price
- €1.221,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa ATP synthase subunit a(atp-6)
- Regular price
- €1.372,95 EUR
- Sale price
- €1.372,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa Mitochondrial inner membrane organizing system protein NCU06495(NCU06495)
- Regular price
- €1.232,95 EUR
- Sale price
- €1.232,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17(tim-17)
- Regular price
- €1.289,95 EUR
- Sale price
- €1.289,95 EUR
- Regular price
-
- Unit price
- per
Sold out