Gene Bio Systems
Recombinant Neurospora crassa Assembly factor cbp-4(cbp-4)
Recombinant Neurospora crassa Assembly factor cbp-4(cbp-4)
SKU:CSB-CF766439NHA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:Q7SDU5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAKKPVNWWLWTKMLLGGAAICVGGPAFTYWLTPTDEELFQKYNPELQKRSLERRFERQ QEFDDFVTKLKEYSKSDKPIWTVQAEAEEKERQQRASVQKSLALADEVKARKEAMRREAG LPLEK
Protein Names:Recommended name: Assembly factor cbp-4 Alternative name(s): Cytochrome b mRNA-processing protein 4
Gene Names:Name:cbp-4 ORF Names:5C2.060, NCU03147
Expression Region:1-125
Sequence Info:full length protein
