Gene Bio Systems
Recombinant Neosartorya fumigata Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
Recombinant Neosartorya fumigata Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
SKU:CSB-CF703358NGS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Uniprot NO.:Q4WP59
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLNEPLPSSMEDNPQFKEETSLQKFRRRLKEEPLIPLGCAATCYALYRAYRSMKAGDSVE MNKMFRARIYAQFFTLVAVVAGGMYYKTERQQRREFEKMVEQRKAQEKRDAWLRELEIRD KEDKDWRERHAAIEAAAKEAGKRPAPKKLPEQDAARSAIEPADERSIGVLSAVRDLWMQQ K
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:aim31 ORF Names:AFUA_4G08130
Expression Region:1-181
Sequence Info:full length protein
