Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A(mrcA) ,partial

Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A(mrcA) ,partial

CSB-EP363014NGG
Regular price
€743,95 EUR
Sale price
€743,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: mrcA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Neisseria meningitidis serogroup B (strain MC58)

Delivery time: 3-7 business days

Uniprot ID: P0A0Z6

AA Sequence: KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 206-413aa

Protein length: Partial

MW: 40 kDa

Alternative Name(s): Peptidoglycan TGase DD-transpeptidase

Relevance: Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits)

Reference: "Complete genome sequence of Neisseria meningitidis serogroup B strain MC58." Tettelin H., Saunders N.J., Heidelberg J.F., Jeffries A.C., Nelson K.E., Eisen J.A., Ketchum K.A., Hood D.W., Peden J.F., Dodson R.J., Nelson W.C., Gwinn M.L., DeBoy R.T., Peterson J.D., Hickey E.K., Haft D.H., Salzberg S.L., White O. Venter J.C. Science 287:1809-1815(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share