Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0756 membrane protein NMA2160 (NMA2160)

Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0756 membrane protein NMA2160 (NMA2160)

SKU:CSB-CF375524NGF

Regular price €1.435,95 EUR
Regular price Sale price €1.435,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Uniprot NO.:A1ITY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSFAPLFLVTLILLGVVSNNNSITISATILLLMQQTALIQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQPVLITGLLIGT VIGVAFMGGIPVGPLIAAGILSFVVGKG

Protein Names:Recommended name: UPF0756 membrane protein NMA2160

Gene Names:Ordered Locus Names:NMA2160

Expression Region:1-148

Sequence Info:full length protein

View full details