Gene Bio Systems
Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0756 membrane protein NMA2160 (NMA2160)
Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0756 membrane protein NMA2160 (NMA2160)
SKU:CSB-CF375524NGF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Uniprot NO.:A1ITY7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFSFAPLFLVTLILLGVVSNNNSITISATILLLMQQTALIQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQPVLITGLLIGT VIGVAFMGGIPVGPLIAAGILSFVVGKG
Protein Names:Recommended name: UPF0756 membrane protein NMA2160
Gene Names:Ordered Locus Names:NMA2160
Expression Region:1-148
Sequence Info:full length protein
