Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria gonorrhoeae UPF0059 membrane protein NGO1768(NGO1768)

Recombinant Neisseria gonorrhoeae UPF0059 membrane protein NGO1768(NGO1768)

SKU:CSB-CF685781NGA

Regular price €1.464,95 EUR
Regular price Sale price €1.464,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

Uniprot NO.:Q5F600

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLYALLLVALGMSMDAFAVALAKGAAVRMPPRKIAATALVFGTVEAFMPLAGWVGGFYA KPFISEWDHWVAFVLLGGLGLKMMREGLSGEAEDVRESKQESLWMTVLTAFGTSIDSMIV GVGLAFMEVNIAFAAAVIGMAATVMVTIGLTAGKAFGVLFGRRAEFAGGLVLIAIGTWTL LSHLGLIQ

Protein Names:Recommended name: UPF0059 membrane protein NGO1768

Gene Names:Ordered Locus Names:NGO1768

Expression Region:1-188

Sequence Info:full length protein

View full details