Gene Bio Systems
Recombinant Neisseria gonorrhoeae Probable intracellular septation protein A(NGO1659)
Recombinant Neisseria gonorrhoeae Probable intracellular septation protein A(NGO1659)
SKU:CSB-CF691683NGA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Uniprot NO.:Q5F6A1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFVSDLLSVILFFATYTVTKNMIAAAAVALVAGVVQAAFLYWKHKRLDTMQWVGLVLIV VFGGATIVLGDSRFIMWKPTVLFWCGALFLLGSHLAGKNGLKASIGREIQLPDAVWGKLT YMWVGFLIFMGIANWFVFTRFEAQWVNYKMFGSTALMLFFFIIQGIYLSTYLKKED
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:NGO1659
Expression Region:1-176
Sequence Info:full length protein
