Skip to product information
1 of 1

Gene Bio Systems

Recombinant Natronomonas pharaonis Uncharacterized protein NP1057A(NP1057A)

Recombinant Natronomonas pharaonis Uncharacterized protein NP1057A(NP1057A)

SKU:CSB-CF659160NAAJ

Regular price €1.359,95 EUR
Regular price Sale price €1.359,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)

Uniprot NO.:Q3IUT9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVEIQTGLRENTVGAVEQFAEIASIDPLVASMILSGAIIITVAVVAFGALTLGAIGASIK RGLSGSEEPNQPA

Protein Names:Recommended name: Uncharacterized protein NP1057A

Gene Names:Ordered Locus Names:NP1057A ORF Names:NP1057E

Expression Region:1-73

Sequence Info:full length protein

View full details