Skip to product information
1 of 1

Gene Bio Systems

Recombinant Naja kaouthia Alpha-cobratoxin

Recombinant Naja kaouthia Alpha-cobratoxin

SKU:CSB-EP365543NAF

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01391

Gene Names: N/A

Organism: Naja kaouthia (Monocled cobra) (Naja siamensis)

AA Sequence: IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP

Expression Region: 1-71aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

MW: 37.8 kDa

Alternative Name(s): Alpha-elapitoxin-Nk2a Short name:Alpha-EPTX-Nk2a Long neurotoxin 1 Siamensis 3

Relevance: Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5 nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105 nM).2 Publications Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7 nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370 nM).However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446): is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release.

Reference: "Naturally occurring disulfide-bound dimers of three-fingered toxins: a paradigm for biological activity diversification." Osipov A.V., Kasheverov I.E., Makarova Y.V., Starkov V.G., Vorontsova O.V., Ziganshin R.K., Andreeva T.V., Serebryakova M.V., Benoit A., Hogg R.C., Bertrand D., Tsetlin V.I., Utkin Y.N. J. Biol. Chem. 283:14571-14580(2008)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details