Gene Bio Systems
Recombinant NAD(P) transhydrogenase subunit alpha part 2
Recombinant NAD(P) transhydrogenase subunit alpha part 2
SKU:CSB-CF313834RMA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodospirillum rubrum
Uniprot NO.:P0C187
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK
Protein Names:Recommended name: NAD(P) transhydrogenase subunit alpha part 2 EC= 1.6.1.2 Alternative name(s): Nicotinamide nucleotide transhydrogenase subunit alpha 2 Proton-translocating transhydrogenase component 2 Pyridine nucleotide transhydr
Gene Names:Name:pntAB Synonyms:nntA2
Expression Region:1-139
Sequence Info:full length protein
