Recombinant Mycoplasma pneumoniae  Uncharacterized protein MG267 homolog (MPN_385)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG267 homolog (MPN_385)

CSB-CF305087MLW
Regular price
€1.007,95 EUR
Sale price
€1.007,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75397

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLKRLIKLAIFLFFVAVGFIIFIGSFWLNTYNTKEWANLLAEKDASGLIVQIIPNINQW FKGTVEQQQKLFQTLVHFFIPVGFGLLFGIAVAIIADLFYHLIKYLIKRSFKKN

Protein Names:Recommended name: Uncharacterized protein MG267 homolog

Gene Names:Ordered Locus Names:MPN_385 ORF Names:F11_orf114, MP452

Expression Region:1-114

Sequence Info:full length protein

Your list is ready to share