Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Lipoprotein signal peptidase(lspA)

Recombinant Mycoplasma pneumoniae Lipoprotein signal peptidase(lspA)

SKU:CSB-CF305098MLW

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75484

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKAPTFFSKLLKQILFANRKPFLYYKLALILFVGFVILFQVFMLRAALNGEKGINGANG TDVARSSFISIYVIGNKGVGFSLLADQPGLVYFLQGFLSFIALFFLVFSTSYNYIFWITT LAFGSLGNFFDRLTSGSGEVLDYFVFSGGNSVFNLADCCITFSFIGLFLSFLIQFFKEMK QTKS

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Synonyms:lsp Ordered Locus Names:MPN_293 ORF Names:MP542

Expression Region:1-184

Sequence Info:full length protein

View full details