Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma hominis Protein LemA(lemA)

Recombinant Mycoplasma hominis Protein LemA(lemA)

SKU:CSB-CF337306MWJ

Regular price €1.502,95 EUR
Regular price Sale price €1.502,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21)

Uniprot NO.:P43054

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLFDSRTPQSSEGFKPNVDNSIKKPIPTGVEKFFFILFFILTIGIFYFVYVGRKNELMRD QNEIQNASSLIQAAEKRRRAVLIKMMDSLIGYKNFENETLSKITQYRSKLSNIDVDKTSP VELKSQIDSIRGALNFQFEQYPDLKASKLYLQFSTEISMQEDEIYATIRNYNMIATSFNS KIYTFWTNCVAQKLDLYNVAIFQASEIERVDVDTSELRN

Protein Names:Recommended name: Protein LemA Alternative name(s): ORF219

Gene Names:Name:lemA Ordered Locus Names:MHO_3750

Expression Region:1-219

Sequence Info:full length protein

View full details