Gene Bio Systems
Recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (Mjls_0012)
Recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (Mjls_0012)
SKU:CSB-CF388257MOL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium sp. (strain JLS)
Uniprot NO.:A3PSE8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGLIWLLVFQLAATNPVD APGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR
Protein Names:Recommended name: UPF0233 membrane protein Mjls_0012
Gene Names:Ordered Locus Names:Mjls_0012
Expression Region:1-94
Sequence Info:full length protein
