Gene Bio Systems
Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252)
Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252)
SKU:CSB-CF371086MVX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Uniprot NO.:A0QXC5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVGKSVVLFVLAAVLEIGGAWLVWQGLREQRGWLWAGAGVIALGAYGFVAAFQPDANFGR VLAAYGGVFIAGSLLWGMIADGFRPDRWDVAGAAVALVGVGLIMYAPR
Protein Names:Recommended name: UPF0060 membrane protein MSMEG_3252
Gene Names:Ordered Locus Names:MSMEG_3252
Expression Region:1-108
Sequence Info:full length protein
