Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

Recombinant Mycobacterium bovis 14 kDa antigen(hspX)

SKU:CSB-BP358651MVH

Regular price €562,95 EUR
Regular price Sale price €562,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P0A5B8

Gene Names: hspX

Organism: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

AA Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Expression Region: 2-144aa

Sequence Info: Full Length

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

MW: 18.1 kDa

Alternative Name(s): 16 kDa antigen HSP 16.3

Relevance:

Reference: "Updated reference genome sequence and annotation of Mycobacterium bovis AF2122/97." Malone K.M., Farrell D., Stuber T.P., Schubert O.T., Aebersold R., Robbe-Austerman S., Gordon S.V. Genome Announc. 5:E00157-E00157(2017)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details