Recombinant Murine coronavirus  Non-structural protein 4 (4)

Recombinant Murine coronavirus Non-structural protein 4 (4)

CSB-CF315044MJY
Regular price
€1.024,95 EUR
Sale price
€1.024,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Uniprot NO.:P0C5A8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVLGPKATLAAVFIGPFIVACMLGIGLVYLLQLQVQIFHVKDTIRVTGKPATVSYTTST PVTPSATTLDGTTYTLIRPTSSYTRVYLGTPRGFDYSTFGPKTLDYVTNLNLILILVVHI LLRHCPGI

Protein Names:Recommended name: Non-structural protein 4 Short name= ns4 Alternative name(s): Accessory protein 4

Gene Names:ORF Names:4

Expression Region:1-128

Sequence Info:full length protein

Your list is ready to share