Gene Bio Systems
Recombinant Multidrug resistance protein mmr(mmr)
Recombinant Multidrug resistance protein mmr(mmr)
SKU:CSB-CF301726MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P69926
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAY ALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH
Protein Names:Recommended name: Multidrug resistance protein mmr
Gene Names:Name:mmr Ordered Locus Names:Rv3065, MT3150.1 ORF Names:MTCY22D7.17c
Expression Region:1-107
Sequence Info:full length protein
