Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse XIAP-associated factor 1 (Xaf1)

Recombinant Mouse XIAP-associated factor 1 (Xaf1)

SKU:Q5NBU8

Regular price €557,95 EUR
Regular price Sale price €557,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: Q5NBU8

Gene Names: Xaf1

Alternative Name(s): BIRC4-binding protein

Abbreviation: Recombinant Mouse Xaf1 protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 1-273aa

Protein Length: Full Length

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: MEADFQVCRNCKRNVASLHFMLHEAHCLRFIVLCPECEEPIPESKMKEHMEVVHQQTKESQQHPAKCKFCELAVQLSNLDVHESHCGSRTEHCPHCNQPITLQVLSQHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQWGW

MW: 38.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondria, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.

Reference:

Function:

View full details