Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse V-type proton ATPase 21 kDa proteolipid subunit(Atp6v0b)

Recombinant Mouse V-type proton ATPase 21 kDa proteolipid subunit(Atp6v0b)

SKU:CSB-CF849642MO

Regular price €1.488,95 EUR
Regular price Sale price €1.488,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q91V37

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGLELLYLGIFVAFWACMVVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA TEPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE IFGSAIGLFGVIVAILQTSRVKMGD

Protein Names:Recommended name: V-type proton ATPase 21 kDa proteolipid subunit Short name= V-ATPase 21 kDa proteolipid subunit Alternative name(s): 23 kDa subunit of V-ATPase Vacuolar proton pump 21 kDa proteolipid subunit

Gene Names:Name:Atp6v0b Synonyms:Atp6f

Expression Region:1-205

Sequence Info:full length protein

View full details