Gene Bio Systems
Recombinant Mouse Tumor necrosis factor ligand superfamily member 12(Tnfsf12)
Recombinant Mouse Tumor necrosis factor ligand superfamily member 12(Tnfsf12)
SKU:CSB-CF023987MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O54907
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 12 Alternative name(s): TNF-related weak inducer of apoptosis Short name= TWEAK Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 12, membrane form 2. Tumor necrosis factor ligand superfamily member 12, secreted form
Gene Names:Name:Tnfsf12
Expression Region:1-249
Sequence Info:full length protein
