Recombinant Mouse Tolloid-like protein 1 (Tll1), partial

SKU: Q62381

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: Q62381

Gene Names: Tll1

Alternative Name(s): (mTll)

Abbreviation: Recombinant Mouse Tll1 protein, partial

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 148-347aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: AATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCP

MW: 29.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development, especially heart development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.

Reference: "Mutations in Rab3a alter circadian period and homeostatic response to sleep loss in the mouse." Kapfhamer D., Valladares O., Sun Y., Nolan P.M., Rux J.J., Arnold S.E., Veasey S.C., Bucan M. Nat Genet 32: 290-295(2002)

Function: