Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse T-lymphocyte activation antigen CD86(Cd86)

Recombinant Mouse T-lymphocyte activation antigen CD86(Cd86)

SKU:CSB-CF004965MO

Regular price €1.566,95 EUR
Regular price Sale price €1.566,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P42082

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Protein Names:Recommended name: T-lymphocyte activation antigen CD86 Alternative name(s): Activation B7-2 antigen Early T-cell costimulatory molecule 1 Short name= ETC-1 CD_antigen= CD86

Gene Names:Name:Cd86

Expression Region:24-309

Sequence Info:full length protein

View full details