Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Synapse differentiation-inducing gene protein 1-like(Syndig1l)

Recombinant Mouse Synapse differentiation-inducing gene protein 1-like(Syndig1l)

SKU:CSB-CF661056MO

Regular price €1.520,95 EUR
Regular price Sale price €1.520,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q3USQ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESLSELQNPLLPRSPTHLHRPYPYPEAPPGWSCQEQLYSFLLGGAGPARAHQLLDPGSL QLAVEAWYRPSCLLGRDKVKEPKAGSCETSFTEAREPLAGPAEEGSEPGQAAEDVTIHTV SYGVQEELQGQEDSQEEESDGTSSESECEDAFLTLPPRDHLGLTLFSMLCCFWPLGIAAF YFSQGTSKAISKGDFRLASTTSRRALFLATLSIAVGAGLYVAVVVALAAYMSQNGHG

Protein Names:Recommended name: Synapse differentiation-inducing gene protein 1-like Alternative name(s): Capucin Caudate and putamen-enriched protein Synapse differentiation-induced protein 2 Transmembrane protein 90A

Gene Names:Name:Syndig1l Synonyms:Gm261, SynDIG2, Tmem90a

Expression Region:1-237

Sequence Info:full length protein

View full details