Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(Sdhc)

Recombinant Mouse Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(Sdhc)

SKU:CSB-CF871934MO

Regular price €1.422,95 EUR
Regular price Sale price €1.422,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CZB0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGTTAKEEMERFWKKNTSSNRPLSPHLTIYKWSLPMALSVCHRGSGIALSGGVSLFGLSA LLLPGNFESYLMFVKSLCLGPTLIYSAKFVLVFPLMYHSLNGIRHLLWDLGKGLAIPQVW LSGVAVVVLAVLSSGGLAAL

Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Integral membrane protein CII-3 QPs-1 Short name= QPs1

Gene Names:Name:Sdhc

Expression Region:30-169

Sequence Info:full length protein

View full details