Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Serine protease inhibitor Kazal-type 3(Spink3)

Recombinant Mouse Serine protease inhibitor Kazal-type 3(Spink3)

SKU:CSB-YP362579MO

Regular price €867,95 EUR
Regular price Sale price €867,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P09036

Gene Names: Spink3

Organism: Mus musculus (Mouse)

AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC

Expression Region: 24-80aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8.1 kDa

Alternative Name(s): P12;Prostatic secretory glycoprotein

Relevance: Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.

Reference: A secretory protease inhibitor requires androgens for its expression in male sex accessory tissues but is expressed constitutively in pancreas.Mills J.S., Needham M., Parker M.G.EMBO J. 6:3711-3717(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details