Gene Bio Systems
Recombinant Mouse Serine protease inhibitor Kazal-type 2(Spink2)
Recombinant Mouse Serine protease inhibitor Kazal-type 2(Spink2)
SKU:CSB-EP806409MO
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cell Biology
Uniprot ID:Q8BMY7
Gene Names:Spink2
Organism:Mus musculus (Mouse)
AA Sequence:HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Expression Region:17-86aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:15.0 kDa
Alternative Name(s):Spink2; Serine protease inhibitor Kazal-type 2
Relevance:Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Reference:"Novel miRNA cluster generated by extensive alternate splicing of a multicopy non-coding RNA from mouse Y-heterochromatin." Bhattacharya R., Dhople V.M., Jesudasan R.A. Submitted (JUN-2009)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:
Tissue Specificity:Expressed in sperm (at protein level). Expressed in testis but not in ovary, brain, heart, kidney or lung. Within testis, expressed in epididymis and germ cells.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=46106
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:69982
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000067117
OMIM Database Link:
Lead Time Guidance:3-7 business days
