Gene Bio Systems
Recombinant Mouse Protein Q300(Hpvc2)
Recombinant Mouse Protein Q300(Hpvc2)
SKU:CSB-CF312549MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q02722
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKCHHAHLQFHFYKFWWEGETNLFYVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAI HCGVFVCVLIFEPGLTM
Protein Names:Recommended name: Protein Q300
Gene Names:Name:Hpvc2 Synonyms:Q300
Expression Region:1-77
Sequence Info:full length protein
