Recombinant Mouse Protein flightless-1 homolog(Flii),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Protein flightless-1 homolog(Flii),partial

CSB-EP884922MO
Regular price
€782,95 EUR
Sale price
€782,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q9JJ28

Gene Names: Flii

Organism: Mus musculus (Mouse)

AA Sequence: VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE

Expression Region: 495-827aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 52 kDa

Alternative Name(s):

Relevance: May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Essential for early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration, by inhibiting Rac1-dependent paxillin phosphorylation.

Reference: "Fliih, the murine homologue of the Drosophila melanogaster flightless I gene: nucleotide sequence, chromosomal mapping and overlap with Llglh." Campbell H.D., Fountain S., Young I.G., Weitz S., Lichter P., Hoheisel J.D. DNA Seq. 11:29-40(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Protein flightless-1 homolog(Flii),partial
    Regular price
    €780,95 EUR
    Sale price
    €780,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Lysyl oxidase homolog 1(Loxl1)
    Regular price
    €782,95 EUR
    Sale price
    €782,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Notchless protein homolog 1(NLE1)
    Regular price
    €611,95 EUR
    Sale price
    €611,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Catalase(Cat)
    Regular price
    €723,95 EUR
    Sale price
    €723,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share