Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse PRA1 family protein 3(Arl6ip5)

Recombinant Mouse PRA1 family protein 3(Arl6ip5)

SKU:CSB-CF844467MO

Regular price €1.475,95 EUR
Regular price Sale price €1.475,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8R5J9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM VFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFA DYISKARE

Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5 Addicsin GTRAP3-18 Glutamate transporter

Gene Names:Name:Arl6ip5 Synonyms:Aip5, Jwa, Pra2, Praf3

Expression Region:1-188

Sequence Info:full length protein

View full details