Gene Bio Systems
Recombinant Mouse Mitochondrial fission process protein 1(Mtfp1)
Recombinant Mouse Mitochondrial fission process protein 1(Mtfp1)
SKU:CSB-CF887445MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CRB8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEQQRQGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKG KKAGEVPSPEAGRNTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTHWPPT VRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKPSTP
Protein Names:Recommended name: Mitochondrial fission process protein 1 Alternative name(s): Mitochondrial 18 kDa protein Short name= MTP18
Gene Names:Name:Mtfp1 Synonyms:Mtp18
Expression Region:1-166
Sequence Info:full length protein
