GeneBio Systems
Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial
Recombinant Mouse LysM and putative peptidoglycan-binding domain-containing protein 3 (Lysmd3), partial
SKU:Q99LE3
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Cancer
Uniprot ID: Q99LE3
Gene Names: Lysmd3
Alternative Name(s):
Abbreviation: Recombinant Mouse Lysmd3 protein, partial
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 1-216aa
Protein Length: Partial
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSRGKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSIHRKDPYYGADWGIG
MW: 31.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Essential for Golgi structural integrity.
Reference: "LysMD3 is a type II membrane protein without an in vivo role in the response to a range of pathogens." Yokoyama C.C., Baldridge M.T., Leung D.W., Zhao G., Desai C., Liu T.C., Diaz-Ochoa V.E., Huynh J.P., Kimmey J.M., Sennott E.L., Hole C.R., Idol R.A., Park S., Storek K.M., Wang C., Hwang S., Viehmann Milam A., Chen E. Virgin H.W. J Biol Chem 293: 6022-6038(2018)
Function:
