Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lymphotoxin-beta(Ltb)

Recombinant Mouse Lymphotoxin-beta(Ltb)

SKU:CSB-CF013220MO

Regular price €1.590,95 EUR
Regular price Sale price €1.590,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P41155

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG

Protein Names:Recommended name: Lymphotoxin-beta Short name= LT-beta Alternative name(s): Tumor necrosis factor C Short name= TNF-C Tumor necrosis factor ligand superfamily member 3

Gene Names:Name:Ltb Synonyms:Tnfc, Tnfsf3

Expression Region:1-306

Sequence Info:full length protein

View full details