Gene Bio Systems
Recombinant Mouse Lymphocyte antigen 6G(Ly6g)
Recombinant Mouse Lymphocyte antigen 6G(Ly6g)
SKU:CSB-EP333994MOb0
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P35461
Gene Names: Ly6g
Organism: Mus musculus (Mouse)
AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Expression Region: 4--96aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
MW: 13.4 kDa
Alternative Name(s): Ly-6G.1
Relevance:
Reference: "Negligible role of antibodies and C5 in pregnancy loss associated exclusively with C3-dependent mechanisms through complement alternative pathway." Mao D., Wu X., Deppong C., Friend L.D., Dolecki G., Nelson D.M., Molina H. Immunity 19:813-822(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
