Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lymphocyte antigen 6G(Ly6g)

Recombinant Mouse Lymphocyte antigen 6G(Ly6g)

SKU:CSB-EP333994MOb0

Regular price €1.016,95 EUR
Regular price Sale price €1.016,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P35461

Gene Names: Ly6g

Organism: Mus musculus (Mouse)

AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Expression Region: 4--96aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

MW: 13.4 kDa

Alternative Name(s): Ly-6G.1

Relevance:

Reference: "Negligible role of antibodies and C5 in pregnancy loss associated exclusively with C3-dependent mechanisms through complement alternative pathway." Mao D., Wu X., Deppong C., Friend L.D., Dolecki G., Nelson D.M., Molina H. Immunity 19:813-822(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details