Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lymphocyte antigen 6G(Ly6g)

Recombinant Mouse Lymphocyte antigen 6G(Ly6g)

SKU:CSB-YP333994MO

Regular price €982,95 EUR
Regular price Sale price €982,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P35461

Gene Names: Ly6g

Organism: Mus musculus (Mouse)

AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Expression Region: 4-96aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.9 kDa

Alternative Name(s): Ly-6G.1

Relevance:

Reference: "The monoclonal antibody TER-119 recognizes a molecule associated with glycophorin A and specifically marks the late stages of murine erythroid lineage." Kina T., Ikuta K., Takayama E., Wada K., Majumdar A.S., Weissman I.L., Katsura Y. Br. J. Haematol. 109:280-287(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details