Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active)

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active)

SKU:P01590

Regular price €341,95 EUR
Regular price Sale price €341,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: P01590

Gene Names: Il2ra

Alternative Name(s): Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA;p55; CD25; Il2ra; Il2r

Abbreviation: Recombinant Mouse Il2ra protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 22-236aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

MW: 26.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/mL can bind Mouse Il2 (CSB-MP011629MOd9). The EC50 is 95.00-116.2 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.

Reference: IL-2Ralpha KO mice exhibit maternal microchimerism and reveal nuclear localization of IL-2Ralpha in lymphoid and non-lymphoid cells. Wong V.A., Dinh K.N., Chen G., Wrenshall L.E. Front Immunol 15: 1369818-1369818 (2024)

Function:

View full details