Recombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K)

SKU: P70380

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P70380

Gene Names: Il18

Alternative Name(s): (IL-18)(Interferon gamma-inducing factor)(IFN-gamma-inducing factor)(Interleukin-1 gamma)(IL-1 gamma)

Abbreviation: Recombinant Mouse Il18 protein (N36H,M85A,K87G,E90R,V91A,L94K)

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 36-192aa(N36H,M85A,K87G,E90R,V91A,L94K)

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

MW: 24.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Regulatory light chain of myosin. Does not bind calcium.

Reference: "Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil." Planelles-Herrero V.J., Hartman J.J., Robert-Paganin J., Malik F.I., Houdusse A. Nat Commun 8: 190-190(2017)

Function: