Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Inhibin beta E chain (Inhbe)

Recombinant Mouse Inhibin beta E chain (Inhbe)

SKU:O08717

Regular price €544,95 EUR
Regular price Sale price €544,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: O08717

Gene Names: Inhbe

Alternative Name(s): Activin beta-E chain

Abbreviation: Recombinant Mouse Inhbe protein

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 237-350aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal hFc-tagged

Target Protein Sequence: TPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

MW: 38.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Reference:

Function:

View full details