
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P01942
Gene Names: Hba
Organism: Mus musculus (Mouse)
AA Sequence: VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Expression Region: 2-142aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 19 kDa
Alternative Name(s): Alpha-globinHemoglobin alpha chain
Relevance: Involved in oxygen transport from the lung to the various peripheral tissues.
Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Hemoglobin subunit alpha(Hba)
- Regular price
- €633,95 EUR
- Sale price
- €633,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Hemoglobin subunit beta-2(Hbb-b2)
- Regular price
- €635,95 EUR
- Sale price
- €635,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Hemoglobin subunit beta-2(Hbb-b2)
- Regular price
- €633,95 EUR
- Sale price
- €633,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Hemoglobin subunit delta(HBD)
- Regular price
- €451,95 EUR
- Sale price
- €451,95 EUR
- Regular price
-
- Unit price
- per
Sold out