Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Galactoside 2-alpha-L-fucosyltransferase 1(Fut1)

Recombinant Mouse Galactoside 2-alpha-L-fucosyltransferase 1(Fut1)

SKU:CSB-CF009073MO

Regular price €1.661,95 EUR
Regular price Sale price €1.661,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O09160

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWTPSRRQLCLTFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCSDYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPASPAHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV

Protein Names:Recommended name: Galactoside 2-alpha-L-fucosyltransferase 1 EC= 2.4.1.69 Alternative name(s): Alpha(1,2)FT 1 Fucosyltransferase 1 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1

Gene Names:Name:Fut1

Expression Region:1-376

Sequence Info:full length protein

View full details