Recombinant Mouse fMet-Leu-Phe receptor(Fpr1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse fMet-Leu-Phe receptor(Fpr1),partial

CSB-EP008854MO1
Regular price
€753,95 EUR
Sale price
€753,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P33766

Gene Names: Fpr1

Organism: Mus musculus (Mouse)

AA Sequence: MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Expression Region: 1-35aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

MW: 33.7 kDa

Alternative Name(s): N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor

Relevance: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Reference: "Species and subtype variants of the N-formyl peptide chemotactic receptor reveal multiple important functional domains." Gao J.-L., Murphy P.M. J. Biol. Chem. 268:25395-25401(1993)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share