Recombinant Mouse Fibroblast growth factor 15(Fgf15)

Recombinant Mouse Fibroblast growth factor 15(Fgf15)

CSB-EP522052MO
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Signal Transduction

Target / Protein: Fgf15

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: O35622

AA Sequence: RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-218aa

Protein length: Full Length of Mature Protein

MW: 38.5 kDa

Alternative Name(s): Short name:FGF-15

Relevance: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.

Reference: "The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share