Gene Bio Systems
Recombinant Mouse Fetal and adult testis-expressed transcript protein homolog(Fate1)
Recombinant Mouse Fetal and adult testis-expressed transcript protein homolog(Fate1)
SKU:CSB-CF805573MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q8CEK7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPWVPREHSHDDVQLQEFSRNFPVGRFPYECLEADIMAKIGLEELNGLEMEVMRRQMQMT SGRLHILEDQDATWCHKEAALFTLLVSVCIANLWLWVHW
Protein Names:Recommended name: Fetal and adult testis-expressed transcript protein homolog
Gene Names:Name:Fate1 Synonyms:Fate
Expression Region:1-99
Sequence Info:full length protein
