Recombinant Mouse Epididymal-specific lipocalin-5(Lcn5)

SKU: CSB-EP381788MO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: A2AJB7

Gene Names: Lcn5

Organism: Mus musculus (Mouse)

AA Sequence: TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

Expression Region: 27-192aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 22.3 kDa

Alternative Name(s): Epididymal retinoic acid-binding protein Short name: E-RABP Short name: mE-RABP Epididymal secretory protein 10 Short name: MEP 10 Cleaved into the following 2 chains: Epididymal-specific lipocalin-5, major form Epididymal-specific lipocalin-5, minor form

Relevance: Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.

Reference: "Isolation, immunolocalization, and sperm-association of three proteins of 18, 25, and 29 kilodaltons secreted by the mouse epididymis." Rankin T.L., Tsuruta K.J., Holland M.K., Griswold M.D., Orgebin-Crist M.-C.Biol. Reprod. 46:747-766(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.