Recombinant Mouse Ephrin-B1(Efnb1)

SKU: CSB-CF007465MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P52795

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Protein Names:Recommended name: Ephrin-B1 Alternative name(s): CEK5 receptor ligand Short name= CEK5-L ELK ligand Short name= ELK-L EPH-related receptor tyrosine kinase ligand 2 Short name= LERK-2 Stimulated by retinoic acid gene 1 protein

Gene Names:Name:Efnb1 Synonyms:Epl2, Eplg2, Lerk2, Stra1

Expression Region:25-345

Sequence Info:full length protein