Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Endothelin-converting enzyme-like 1(Ecel1),partial

Recombinant Mouse Endothelin-converting enzyme-like 1(Ecel1),partial

SKU:CSB-EP878117MO

Regular price €910,95 EUR
Regular price Sale price €910,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q9JMI0

Gene Names: Ecel1

Organism: Mus musculus (Mouse)

AA Sequence: MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Expression Region: 1-61aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 13.7 kDa

Alternative Name(s): Damage-induced neuronal endopeptidase Xce protein Dine, Xce

Relevance: May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.

Reference: "Neonatal lethality in mice deficient in XCE, a novel member of the endothelin-converting enzyme and neutral endopeptidase family." Schweizer A., Valdenaire O., Koster A., Lang Y., Schmitt G., Lenz B., Bluethmann H., Rohrer J. J. Biol. Chem. 274:20450-20456(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details